LL-37
5mg
- Ships same or next day Orders before 3PM EST, FedEx 2-Day Air
- Verify this lot View the lab reports · View the Vanguard certificate
- Real U.S. support Live chat and email, 7 days a week
For research use only. Not for human or veterinary consumption.
Certified-Pep only sells U.S.-made peptides and products.
Key Features:
Made in the USA
Batch tested at a verifiable U.S. laboratory for identity, content and purity
Screened for endotoxins, heavy metals and sterility
Rigorous quality testing on every batch
All products are delivered in lyophilized powder form
For laboratory and research use only
- PURITY: 99%+
- CAS: 154947-66-7
- FORM: LYOPHILIZED POWDER (trifluoroacetate salt)
- DOSAGE: 5 MG
- PURITY: 99%+
| LL-37 5MG | |
|---|---|
| SKU | CP_LL_37_5MG_3ML_VIAL |
| CATEGORY | Bioregulator Peptide |
| CAS | 154947-66-7 |
| VIAL SIZE | 3 mL |
| FORM | LYOPHILIZED POWDER (trifluoroacetate salt) |
| MOLECULAR WEIGHT | 4493.34 g/mol |
| SEQUENCE | [LL-37, 37 aa] |
| MOLECULAR FORMULA | C205H340N60O53 |
| ITEM ID | 17044 |
Szarszoń et al. (2026) characterized Cu(II) and Zn(II) coordination chemistry of LL-37, its C-terminal fragment DF-12, and an all-D stereoisomer analogue (df-12) using potentiometric, spectroscopic, and microbiological methods. At physiological pH, both metal ions bound through the N-terminal amino group and a carboxylate donor, with divergent coordination pathways at higher pH. LL-37 retained its α-helical conformation upon metal binding. In antimicrobial and antibiofilm plate assays, full-length LL-37 displayed the broadest activity spectrum among the tested peptides. Truncation altered antibacterial assay outcomes, although DF-12 and df-12 showed measurable antifungal and antibiofilm activity with low cytotoxicity in the cell models tested [42708248].
Sale